PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00241_0100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family MYB
Protein Properties Length: 1008aa    MW: 110159 Da    PI: 8.208
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00241_0100genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.12.1e-13100147148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT eEd++l + v+  G ++W+++    g+ R++k+c++r+ ++l
    kfl00241_0100 100 KGAWTDEEDQILREHVTTTGEKDWNRVKMVYGLQRSGKSCRLRYMNHL 147
                      79********************************************96 PP

2Myb_DNA-binding26.91.1e-08153196146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      + r+T  E  l  ++  ++G++ W++Ia+++  gRt++++k+ w++
    kfl00241_0100 153 KERFTGAELRLVMQLQGRYGNK-WALIANHFK-GRTDNEVKNAWHT 196
                      56889999999999999*****.********9.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.3195151IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.1E-1897150IPR009057Homeodomain-like
SuperFamilySSF466894.39E-2498194IPR009057Homeodomain-like
SMARTSM007173.0E-1199149IPR001005SANT/Myb domain
CDDcd001674.88E-9102147No hitNo description
PfamPF139216.4E-12103160No hitNo description
Gene3DG3DSA:1.10.10.606.3E-16151199IPR009057Homeodomain-like
SMARTSM007174.2E-7152200IPR001005SANT/Myb domain
PROSITE profilePS5129413.068152202IPR017930Myb domain
CDDcd001679.57E-6155196No hitNo description
SuperFamilySSF563496.77E-16804997IPR011010DNA breaking-rejoining enzyme, catalytic core
Gene3DG3DSA:1.10.443.102.2E-20805997IPR013762Integrase-like, catalytic domain
PfamPF005892.9E-6818996IPR002104Integrase, catalytic domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006310Biological ProcessDNA recombination
GO:0015074Biological ProcessDNA integration
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1008 aa     Download sequence    Send to blast
MGGVGTNTGP PSHPWCNWAA NNGSNPNMAN AYQSAYQLSA GRWTANKNTL TWQGGSSVGN  60
TCATDYLNSV LLDGTDDFGG WKREADTNPL EERAPDPLRK GAWTDEEDQI LREHVTTTGE  120
KDWNRVKMVY GLQRSGKSCR LRYMNHLRPH LKKERFTGAE LRLVMQLQGR YGNKWALIAN  180
HFKGRTDNEV KNAWHTRRRQ MERERRKALK WQAAEQSGAC TASCGSDVID GRGCAASSLC  240
GMGAVHSHGS QELFCSEQLP GRPFDPPAAA YGAHLGMDVP VTHPSLVLPD ESYPGPWNQP  300
LSQWPDYPAS ESCSPQAYPP VTFTGPLQLA PIPKTQSSGS LSTVHSCTPV LYGCHVATLE  360
RAASTVTDAS VGLVIEGPSV SSLAARSFVG DGGENGARPA ESVCSAAAKE DTWPFEAARL  420
ATPFLAEPAT GASSPGTKLR IPAPPRLVIP DAEPDRYDAS WADNIYLSPI GPFPNLSPVL  480
PLQSRSPFDF GPPNGSVGSY RSRSPFDLAP PIASVGPYRS RSPFDVGPHS APVGQYRPHP  540
QARGQLPGGS APWTSAQFSS CETGWRATWG EELDALLTSR HAELALEVRV GGERPFGDDV  600
FSRARASESS AACGVRQNSV WRPWGAVEGT GGARSSSLDE GSLRTEAQGL WKRARGVEGV  660
VKEPVNRWGD DEIRRFYAES LQTAAGIANR GVSEGFEDGR KRTWSEFREF CEHVGIAADQ  720
AADVDVLAFV QGFWLPRHLG ACRTFGSEGE KVASASAIKA VLSHLGKSFS MLGRSAGENP  780
VHSESVRSYR EGYRNWLHDL GVREKRAKVF AESKVNDLLR WLQDEVEKKS GLGKCCALTD  840
LAIVNYLWES WSRGRECGEL EARQVGFKTE IVVPGWSKTV RTEPSAEIPV SGGFLEAAAR  900
LISACENEGQ AVGSGFLFRP LNARKNGFKN EAMKNGTMRR RVQQRLKEAG LFEGETLHSF  960
RRSAVQHAAE IEGYDVPRLM ARGRWSSYAA FRIYVEEIAS RFPRRLLR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-219820025126MYB TRANSFORMING PROTEIN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.11e-29myb domain protein 66